PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_014177-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 361aa    MW: 40685.4 Da    PI: 9.243
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_014177-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.4e-1688134248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g+WT+ Ed ll+++++ +G g+W++ +++ g+ R++k+c++rw +yl
    NNU_014177-RA  88 GPWTAREDTLLIKYIEAHGEGHWRSLPKKAGLLRCGKSCRLRWMNYL 134
                      89*****************************99************97 PP

2Myb_DNA-binding47.44.5e-15140185148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+  ++E++l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
    NNU_014177-RA 140 RGNIGADEEDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 185
                      677779****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.65682134IPR017930Myb domain
SMARTSM007171.8E-1086136IPR001005SANT/Myb domain
PfamPF002493.6E-1487134IPR001005SANT/Myb domain
SuperFamilySSF466892.22E-2787181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-2288141IPR009057Homeodomain-like
CDDcd001675.37E-1089134No hitNo description
PROSITE profilePS5129422.662135189IPR017930Myb domain
SMARTSM007171.8E-14139187IPR001005SANT/Myb domain
PfamPF002491.3E-13140185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-24142188IPR009057Homeodomain-like
CDDcd001673.06E-10145185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MVVVLWAYLH LRGRLYSSSL KLVRALNLNF DGMGARPRIH GVFAAXENVD NADPVTARSN  60
ASLSQQKRSS RPQGSMNYEI RLPQDWTGPW TAREDTLLIK YIEAHGEGHW RSLPKKAGLL  120
RCGKSCRLRW MNYLRPDIKR GNIGADEEDL IIRLHSLLGN RWSLIAGRLP GRTDNEIKNY  180
WNTHLSKRFK SHGTESNVKK RAPRPTDRDP KKREKKSNGN GNKKQKKSSS SRGNEDTAEI  240
KVHLPKAIRI TSLPISRNNS FEYNSVLSGS PASQQGGVDT ETEDLQVPWS SEIKDAGGEG  300
DCSGVVINAG DEDHDHEGVN ECESQIPKDN MLEKLYKEYL QLLNPEEDQA QLDSFAESLW  360
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22881918110B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267522.10.0PREDICTED: myb-related protein 308-like
TrEMBLD3XFF81e-107D3XFF8_THECC; TT2 like MYB transcriptoin factor
STRINGVIT_15s0046g00170.t012e-96(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.17e-57myb domain protein 5